SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037874|ref|YP_003798196.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037874|ref|YP_003798196.1|
Domain Number 1 Region: 7-278
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3e-64
Family G proteins 0.0000075
Further Details:      
 
Domain Number 2 Region: 479-599
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2e-43
Family Translational machinery components 0.00000975
Further Details:      
 
Domain Number 3 Region: 262-404
Classification Level Classification E-value
Superfamily Translation proteins 2.4e-28
Family Elongation factors 0.00038
Further Details:      
 
Domain Number 4 Region: 603-698
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.76e-24
Family EF-G/eEF-2 domains III and V 0.00033
Further Details:      
 
Domain Number 5 Region: 402-480
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.05e-21
Family EF-G/eEF-2 domains III and V 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302037874|ref|YP_003798196.1|
Sequence length 701
Comment elongation factor G [Candidatus Nitrospira defluvii]
Sequence
MNVPLTESIRNVAVVSYAGSGKTSLVEALAYCAGSLPAPGSVSAGTTVSDFEPEEIHHRT
SLNTAVIRCSYQNRVLNLLDTPGSSSFIGETRSALRAVDGVIVVVSAASGVRSALQRLWW
MIRDSGLPCVVFVNDLDKDGTAFENTVEALTKELEMTAVPLILPMGNGAQLGDIVDLLQN
RVVTTRSDRPQSQPAPVPPEWRDRVDQARRRVMELVAEGDEALLERYLTDGVLTDEALLE
GLQAGVQCASLVPIVGGSAIRHIGVHTLLQSLVDLVPSPAGRAHVAPLQGVGLIEGGESI
TRNPLPTDPFSALVFKTLIDPFIGRLSYMRVYSGTLEADTAVYNSTRQVRERGGHLFSIF
GKKYTPITRAAAGEIVAIGKLKDTVTGDTLCDEHVPIRYPGIPFPRPVVSFAIEPKSKTD
IEKVSLGLHKLIEEDPSLEFVRHIETKEMVLSGMGQLHIDVALEKLHRKYGADVIVHAPK
IPYRETIRSVAQAQGKYKKQTGGHGQYGDCWLEVGPLPRGQGFEFENKIVGGAIPRNFVP
AVEKGVVEALHEGPLAGYPAVDVRVTVYDGSYHVVDSSELAFKIAGSMGVKKALEAAHPI
LLEPLMTVEVEVPAECVGTVLGDVNARRGRILMVEANGHIEIVKALVPQAEMLNYAASLN
SMTGGQGSYAMEHAHYEEVPRELAGRIIEEHKMERHGAVVH
Download sequence
Identical sequences D8PG84
WP_013249092.1.3676 gi|302037874|ref|YP_003798196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]