SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037917|ref|YP_003798239.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037917|ref|YP_003798239.1|
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily Transposase IS200-like 7.72e-26
Family Transposase IS200-like 0.0086
Further Details:      
 
Weak hits

Sequence:  gi|302037917|ref|YP_003798239.1|
Domain Number - Region: 239-275
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.000719
Family YlxM/p13-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302037917|ref|YP_003798239.1|
Sequence length 278
Comment hypothetical protein NIDE2608 [Candidatus Nitrospira defluvii]
Sequence
MARPLRLSFPGAVYHVTSRGNARHDIVADDRDRSQWLSLLAHVVDRYGWLCHAYCLMDNH
YHLVIETPKPNLSIGMRQLNGRYTQAYNRRHEQVGHVFQGRFTAILVEKDAHLLELCRYV
VLNPVRAKIVSHPRLWVWSSYRATVGETKAPGWLTTDWILSQFGQRGGAAQARYRTFVAE
GRGGPAPWEQLTGQIYLGSEKFVAQHQPNRVIRDIPRRQTQAQRPSLETLFEWKGALEKT
IHQAYRQYGYRLADIADHLGVHAATVSRRLKRAEQENV
Download sequence
Identical sequences D8PGC7
gi|302037917|ref|YP_003798239.1| WP_013249135.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]