SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037947|ref|YP_003798269.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037947|ref|YP_003798269.1|
Domain Number 1 Region: 13-271
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.77e-56
Family FAD-linked oxidases, N-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 273-516
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 3.27e-51
Family Cytokinin dehydrogenase 1 0.04
Further Details:      
 
Domain Number 3 Region: 492-607
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 0.00000000000165
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302037947|ref|YP_003798269.1|
Sequence length 946
Comment FAD/fMN-containing dehydrogenase subunit GlcDF [Candidatus Nitrospira defluvii]
Sequence
MTLILPNTSSVVVSGLRQLLGQAKVRNDVPALTAYAVDASIYRVQPQAVVLAEHEGDIEA
VVRFAVERGIPLTPRAAGTNLTGSAIGSGIILDISKLNRILEVNEEERRARVQPGIVLAE
LNKQLGRRNLLFGPDPSSGDMCKLGGMLANNSAGPHTLIYGSVKDNVQAMRVCLPSGSWL
SASSMNLNDPELDRTLAAHPSLKPILDLVQRQRSLIDSKKPTVSKNSCGYNLFGLADGLS
RGCFDLPKLFVGSEGTLGVVSEATLRLVPKPQGTLTALIHFRRLEEVGEAVPHLLSLRPS
ALEVMDANTLNLIGRSAHGIPADAAATLLAELDSSAGEGDLRERADQMAAICGRYQLCGD
LTIAYDKEQRDQLWKARKALYPTLYRFDPRKKPINFVDDVVVPATRISELIRYLETFFEG
QHVPVAIFGHIGNGNAHITPLLDVNDRRDFDKMVQAYHEIHGAVLSRFEGSICGEHGDGR
VRAEYVRKMFGDELYQLFVQVKQTLDPANVMNPGIKISETPFTEHIDYQRLSKSCATCAK
CNSVCPVYDVFQSEDMSSRGWFEIVTAKDYSYLDSKRVVEACLNCKSCRTICPAGVDVSE
LILQRRAENPNRGSRWLFALQAKLPVFEAILTLLARTQSWWDRPAPRALLERLAAPLLKR
IAPTAKLPADMVLPTLATTHLRDRYSELTQPAKSKTGSRVAYFHGCAANYFEDGVGDAVI
SVLRKHHVEPELPPQRCSGTPIETYGHVDLVKDNARFNLQSLAGYDQVVTGCASCTLMLK
EYKKFFESGPEQQAADALAKKVVHITEFVARSDQHPPMGTPEARTGKVTYHSSCHLRAAG
VTKEPRQLLKQLPGSDYVEMTDADRCAGGAGTYLVKDYDTSQKVFDRKRRNIEQSGAETV
ATSCPACMIQLSNGMRGRVAVKHVAQLLNDAYEAGAATDRGPGAGQ
Download sequence
Identical sequences D8PGF7
WP_013249165.1.3676 gi|302037947|ref|YP_003798269.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]