SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302037950|ref|YP_003798272.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302037950|ref|YP_003798272.1|
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.14e-24
Family Cold shock DNA-binding domain-like 0.0000823
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302037950|ref|YP_003798272.1|
Sequence length 72
Comment cold shock protein CspA [Candidatus Nitrospira defluvii]
Sequence
MKTKGTVKWFNDRKGFGFIRLDGGDDVFVHYSALQGEGFKTLKEGENVEFDIVQGAKGPQ
AANVLKDLATAS
Download sequence
Identical sequences A0A1W1HNS6 D8PGG0
gi|302037950|ref|YP_003798272.1| WP_013249168.1.3676 WP_013249168.1.96234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]