SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302038043|ref|YP_003798365.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302038043|ref|YP_003798365.1|
Domain Number 1 Region: 546-796
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 4.06e-38
Family Pce catalytic domain-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302038043|ref|YP_003798365.1|
Sequence length 843
Comment putative competence protein ComEC/Rec2 related protein [Candidatus Nitrospira defluvii]
Sequence
MLPTLTIIFVLGLVLGSYLTYFPLSIAIVLLACTAGCVWLERQHRLTSRQSHVLLACLFG
GCLYWTLCASFTPRVLLQDRSDALPVRLTGTIVEAVRHAPGRLTAMVQVTGSDDPQLSIP
FHLRLTWRDPDRDLRRGLQIRTRIHVHAPSGTLNPRGFDYAAYLDALGVDAVGSVSGAGV
IEVLDPDREAPLHLFGSLIEEWRGRVRAAAETLPQPSRGLFLSLTIGEQGFLAPEVREWF
MTTGTVHILSISGSHLGLIALLSFALVRKACLLLPSILLLSLSRWLTATRLAALLTLVPV
LAYTVLAGAETATIRSAIMIAVALVTVWLGSPHYLLHALAAAAGLTLLVHPAALFDISFQ
LSYVSVWALALALSRETPVDELPLPQESPAGRMVYWFHESLRLTSLVTLATVPLVACYFN
QVSWMGVFANLLMVPFVGFVFLPISLLSAVWVMATHSSTLPGAAFIDSLGQGLIASTHVL
AGLPGAEWFVAAPTIPMMLLFYLLGWALLAGWPAHAAPLLRRSMASGLACILLWWLWSPR
PFGGEEMVRVTFLDVGQGDSAVIELPDGTVTLIDGGATYERFDMGRSVVAPFLWNRGIRS
IDHVIGTHPQLDHVGGLAWILAHFQVENFWTNGASRQEEFWRRIERAMVQRKLEATVATE
GRLISEGSACRMVVLNPQPRPESSTSAKSESLNNLSVVTELVCREQRLLFTGDIEREALT
RLTDSGTSDHIALLKVPHHGAKSSLERRWLETIRPAVAVVSAGRRNPYGHPAGDVLAAYE
AVGTQLWRTDRDGAIWADLELRRQRLSIHSTREGILQPALPTAKMWSIEQDNLRRLWRRW
NWM
Download sequence
Identical sequences D8PGQ3
WP_013249261.1.3676 gi|302038043|ref|YP_003798365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]