SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302038095|ref|YP_003798417.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|302038095|ref|YP_003798417.1|
Domain Number - Region: 36-74
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.0273
Family Aromatic dioxygenase reductase-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302038095|ref|YP_003798417.1|
Sequence length 100
Comment hypothetical protein NIDE2787 [Candidatus Nitrospira defluvii]
Sequence
MAFNQVGDFWLAPGQSTRVHIALGGLVNEAEWGGHDFGAQWIMADGVGINPVRLMVSQHT
KEKKPIRLHPGSPSPIVYSVTVTNIGEELAHFTIQGGGNV
Download sequence
Identical sequences A0A1W1HP66 D8PGV5
gi|302038095|ref|YP_003798417.1| WP_013249313.1.3676 WP_013249313.1.96234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]