SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302038191|ref|YP_003798513.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302038191|ref|YP_003798513.1|
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 8.25e-47
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0000183
Further Details:      
 
Domain Number 2 Region: 316-437
Classification Level Classification E-value
Superfamily UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 7.19e-34
Family UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 0.0027
Further Details:      
 
Domain Number 3 Region: 198-305
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 5.95e-19
Family UDP-glucose/GDP-mannose dehydrogenase dimerisation domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302038191|ref|YP_003798513.1|
Sequence length 448
Comment UDP-glucose 6-dehydrogenase [Candidatus Nitrospira defluvii]
Sequence
MGTGYVGLVSGACLAERGHQVTCIDIRPEVVQEINAGRPPIHEIGLDKLLRSARDKGMLS
ATTDAKTAILDSDVTLICVGTPTVDGRMDMSQIVAAAKEIGSALASKRGYHVVAVKSTVL
PGTTEGPVKAAIESHVGRKVGDGWGLCMNPEFLREGRAVEDFRVPDRIVVGVTDSMTAEV
FLNVYADFTCPKLVTTPRTAEMIKYVSNSLLATMISFSNEIGNMCSAVPGVDARLVWKGV
HLDRRLTPINGQVGGAAGVTEYLWHGLGFGGSCFPKDVAALRSFGRTVGEQTRMLDAVLD
INADQPLRMVALLEKELKLAGKTVAVLGLAFKPGTDDLRESPALPLVAELRRKGAKVLAH
DPIAMPHAKKRPEFRDVVFAEGWEEALKKSDACCLVTAWPEYRSIQPTDFLKLMTRALVI
DGRGVFEPAAMAAAGVVWRGVGYTPEFT
Download sequence
Identical sequences D8PH51
gi|302038191|ref|YP_003798513.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]