SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302038212|ref|YP_003798534.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302038212|ref|YP_003798534.1|
Domain Number 1 Region: 84-238
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.14e-31
Family RecO C-terminal domain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 1-81
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.57e-18
Family RecO N-terminal domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302038212|ref|YP_003798534.1|
Sequence length 252
Comment putative DNA repair protein RecO [Candidatus Nitrospira defluvii]
Sequence
MPLVKTAAIVLHSRKWGDADRIVTFYTMRLGKLRGVARGARRLKSRLGGMIEPFTLCQLD
LFEKPGDSLYRISQVALDEPFAKFRDDLTLMTAAGRMVNLVSAVMAEGDPEPRVFEMLES
GLRTLLESRDAAWTTLLFQIRLLGMTGFRPQTEQCATCGQVHRSPLPQFSPMAGGIVCER
CASRQPFRCTALSRGSVAFLHQALHMQPALLNRLHAAGQVRTEVESAIESYVTVVAGRRL
PPVDFLTSGSPV
Download sequence
Identical sequences D8PH72
gi|302038212|ref|YP_003798534.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]