SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302038228|ref|YP_003798550.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302038228|ref|YP_003798550.1|
Domain Number 1 Region: 3-210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.44e-47
Family Extended AAA-ATPase domain 0.00011
Further Details:      
 
Domain Number 2 Region: 248-335
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 0.0000907
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302038228|ref|YP_003798550.1|
Sequence length 343
Comment DNA polymerase III subunit delta' [Candidatus Nitrospira defluvii]
Sequence
MPFADIIGHDSAKTLLRSAIAQNRLAHAYLFHGDDRIGKRLLALRLAQALLCETVSNEQA
PNACGACRACRQVDARTHPDFMVIEPDQELANPQIKIELIRDIEHQMIYRPLIGDRKICL
IDDADRMTIGAANALLKTLEEPPDHSLFILVSSRPYALPATIRSRCQALRLTAPAQTQVE
AAVILKRELPPADAHFLAVLSDGQLGRALECDLEQARNSQKEFAVIFSSKGLQSYSTVLA
AAEALSKEERGPEAFDWLLRWLRDILLVAVGTGSDHVLNLDQKAGMQALAERIDIDELLD
LINDLEKLERQAHRNLNVQMALETILLRVRHLLTPQDTADTPR
Download sequence
Identical sequences D8PH88
WP_013249446.1.3676 gi|302038228|ref|YP_003798550.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]