SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302038229|ref|YP_003798551.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302038229|ref|YP_003798551.1|
Domain Number 1 Region: 4-347
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 9.38e-109
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000012
Further Details:      
 
Domain Number 2 Region: 353-515
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 8.6e-34
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00044
Further Details:      
 
Domain Number 3 Region: 558-662
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.08e-30
Family Myf domain 0.0000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302038229|ref|YP_003798551.1|
Sequence length 663
Comment methionyl-tRNA synthetase [Candidatus Nitrospira defluvii]
Sequence
MNKRDTFYITTPIYYVNDVPHIGHAYTTVAADVLARYWRLRGRDVFFLTGLDEHGQKVQQ
AAAKAGVAPQAHCDRLAPQFTNLWQRLNISNDAFIRTTDKPHQAVVQRYLQQLYDKQLIY
KADYTGWYCTYDERFWTEKDVVNGLCPDCKRPIERLSEHNYFFKMGQYQERLIEHIRTHD
DFIRPVSRRNEVLGFLQTQKLGDLSISRPKSRLSWGIELPFDKEYVTYVWFDALVNYVSA
LEYKPGLERFWPADAHLVGKDILTTHAVYWSTMLMALERPLPHSIFAHGWWTVDGEKMSK
SRGNVVDPNAMIDQFGADAFRYFLLREVPFGQDGDFSRTTMVTTINSALANGIGNLLSRT
LTMIERSCAGTIPDRGPAVLPELEQRIEDVARQLPGRIEAGYNALLFRDVLLMVEELNSA
CDEYIDKSAPWKLAKQPEAQPQLHTVLNTSARALRLLAILLYPFMPTAAQQMIHQLGLSL
DLSQPVSDENSSWDKTLAGSRIQKGASLFPRIETKPQGAKPVSETPASPQPSPVTPSPAA
AQSSAPPVAAPAAAQPAQIGIDDFMKIQLKAAKVLAAERVPKSEKLLKLQVSLGSEQRQI
VAGIGKKYEPETLIGKTIVIVANLKPAKLMGIESQGMVLAAGDSEVRGLATFIEDVEPGT
KVK
Download sequence
Identical sequences D8PH89
gi|302038229|ref|YP_003798551.1| WP_013249447.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]