SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302038405|ref|YP_003798727.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302038405|ref|YP_003798727.1|
Domain Number 1 Region: 2-225
Classification Level Classification E-value
Superfamily Heme oxygenase-like 1.59e-31
Family PqqC-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302038405|ref|YP_003798727.1|
Sequence length 255
Comment hypothetical protein NIDE3106 [Candidatus Nitrospira defluvii]
Sequence
MSFYEHVRADVLRHGAINNTYLTRFQAGEVTDREFHEFAVEFYSFARFFPRILAAQLVNT
EDEAVADELTKVLYSELGDGVVKHRHELLYRNFLRSIGIDIHDAMHTPMKPSTRAYIQGM
ERLYSSRRHATALGASFGLENMAITMWDHLIPGLARLKQVRYPRMDMTYFTFHRQLESEH
ERAMEHAVEAVGGAGANGCATISAQEQRDFCLGMNAVLDYLEGFWMGLERKVSGIRRSRP
RPARQLASELRGQSH
Download sequence
Identical sequences D8PHR5
WP_013249623.1.3676 gi|302038405|ref|YP_003798727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]