SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302038412|ref|YP_003798734.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302038412|ref|YP_003798734.1|
Domain Number 1 Region: 168-378
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 5.78e-79
Family CAT-like 0.0000057
Further Details:      
 
Domain Number 2 Region: 1-81
Classification Level Classification E-value
Superfamily Single hybrid motif 4.58e-25
Family Biotinyl/lipoyl-carrier proteins and domains 0.00034
Further Details:      
 
Domain Number 3 Region: 99-141
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.00000000000654
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302038412|ref|YP_003798734.1|
Sequence length 385
Comment putative branched-chain alpha-keto acid dehydrogenase, dihydrolipoamide acyltransferase (E2) component [Candidatus Nitrospira defluvii]
Sequence
MATDIVMPQLGESIAEGTVVRWLIPQGGAVEKDQPLLEVETEKVALDIPSPATGFLTEIL
VPEGTTVPVGTMLAKLDTQPASGVVNRVGGVTVRPMEAAQGERHYSPAVRQLAKEHGLDL
SAITGTGEGGRVTKHDLLDVIGTRESTGRVQKTLAATPSPPPASTIEEIVPLSQMRKTIA
ERMVLSRHTAAHVATFFEADFSGVAGFREGRALTYLPFVVSAVTRAIREHPLLNSSWREQ
GLVMKNDRHIGIAVALDDGLLVPVIRHADRKGLNQIAHEITDLADRARSKRLRPEEVQDG
TFTITNHGGFGSLFSTPIINQPQTAILGVGSVQKRAVVINDAIAIRTMCYLSLSFDHRVI
DGATADRFMARVKQHLEESDWEKLL
Download sequence
Identical sequences D8PHS2
gi|302038412|ref|YP_003798734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]