SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302038462|ref|YP_003798784.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302038462|ref|YP_003798784.1|
Domain Number 1 Region: 14-341
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 1.19e-107
Family Tex N-terminal region-like 0.0000000148
Further Details:      
 
Domain Number 2 Region: 342-494
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.21e-50
Family Tex RuvX-like domain-like 0.00000137
Further Details:      
 
Domain Number 3 Region: 495-583
Classification Level Classification E-value
Superfamily RuvA domain 2-like 1.7e-27
Family Tex HhH-containing domain-like 0.0000913
Further Details:      
 
Domain Number 4 Region: 662-749
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.27e-24
Family Cold shock DNA-binding domain-like 0.0000293
Further Details:      
 
Domain Number 5 Region: 585-657
Classification Level Classification E-value
Superfamily RuvA domain 2-like 1.27e-19
Family Tex HhH-containing domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302038462|ref|YP_003798784.1|
Sequence length 799
Comment putative transcriptional accessory protein [Candidatus Nitrospira defluvii]
Sequence
MSSSTIPTISPAAQQRIVDLIAKELGVTAPQIAAAVTLLDGGATVPFIARYRKEATSNLD
DTHLRSLEERLLYLRELEERRQTILASIEEQGKLTDELRRAVEQAATKQAVEDIYLPYKP
KRRTKAQIAREAGLEPLANALLADPTLDPDQEAAKYVKVVPAAEGVDAINVPDAKTALEG
ARDILVERFAETAELLATLRAKLWNEGIVTSTVMPGQETAEEEKFRDYYAYSETIRTIPS
HRALAMFRGRTLGVLKLDLGLGESLEAVVPHPCAAMIAAHFGIEHRGRRADKWLTDVCYW
AWRVKVHLHLSTELLLQVREAAEAEAIKIFGRNLHELLLAAPAGPKAVLGLDPGLRTGCK
VAVVDATGKLLDTATIYPHQPRNDWQGALATIVQLVLRHGVELISIGNGTASRETDKFAA
EVVKLVGEQKPEQKLAKIVVSEAGASVYSASAFAAAEFPALDVSLRGAVSIARRLQDPLA
ELVKIDPKSIGVGQYQHDVNQRALARSLDATVEDCVNAVGVDVNTASAPLLARVSGLNRV
LAQNIVEYRDTHGRFQNRHMILNVPRLGEKTFEQAAGFLRINDGDNPLDRSAVHPEAYPV
VERMLARLKKGIAEVMGKPAVLKELSPAEFTDETFGLPTVRDILTELEKPGRDPRPEFKT
ATFRDGVESLADLQPGMVLEGVVTNVAAFGAFVDIGVHQDGLVHVSALANKFVKDPHEVV
KPGQIVKVKVLAVDVPRQRISLTMRMEDAATPASQPDPRAGGPRDTRDRRPADQQRGGSR
EPQPIGAFALALARAKEKK
Download sequence
Identical sequences D8PHX2
gi|302038462|ref|YP_003798784.1| WP_013249680.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]