SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302038779|ref|YP_003799101.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302038779|ref|YP_003799101.1|
Domain Number 1 Region: 1-459
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 3.27e-103
Family Outer membrane efflux proteins (OEP) 0.000000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302038779|ref|YP_003799101.1|
Sequence length 481
Comment RND efflux system, outer membrane factor lipoprotein [Candidatus Nitrospira defluvii]
Sequence
MRMLALLISSVLLGACAIGPDYSRPDLAVPDRFRMAATQQETESFANLPWWDLLQDEQLR
RLIRVALAENKDLKRAVASVEDFQARMLIAKMDFAPKADLTSNAPLFGRKANFLFPGFPN
PFNYYLQGNLSWEIDIWGRIRRSNEAARGDLLSREEARRAVVLQLVSGVAEAYFDMLQFD
MQLAVAQRTLKSWDESVRIAEARLREGMISKIDADQFAAERANAAARAAELSRQMVQKEN
QLSVLLGRVPGQIPRGRSLTDQVMPPEVPAGLPSELLQRRPDLVQAEQELAAATARIGVA
KADRFPKLSITGILGVASPQLSRLVANETAFGVAGPGLTGPLLNAQILGFQQDAAEAQSR
EALARYEQSLLVAFREVEDALVAVRTVREQRTAQVEQVDALRSALRLANLRYKGGLANYL
DVLVAQRNLFDAELALTSTHRLQLVSVVQLYKALGGGWSPLDTAQQQPGQAPAAPGKAGR
G
Download sequence
Identical sequences D8PIT9
gi|302038779|ref|YP_003799101.1| WP_013249996.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]