SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302038888|ref|YP_003799210.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302038888|ref|YP_003799210.1|
Domain Number 1 Region: 163-310
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.88e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.026
Further Details:      
 
Domain Number 2 Region: 25-149
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000112
Family Glutathione S-transferase (GST), N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302038888|ref|YP_003799210.1|
Sequence length 314
Comment putative glutathione S-transferase [Candidatus Nitrospira defluvii]
Sequence
MRAQPQFPNEQTDSGEFKRQSDAFRHWVTEDGRSGYPAAAGRYHLYVSLACPWAHRTIIV
RALKGLTGVIGMTVVDPIRDDQGWAFRNGPGHSLDTTNGFHFLSEAYRATDPDYRGRVTV
PALWDTVTKRIVTNSDDDLMRIFNSEFNDFTASSLDLYPAALRPQIDEMNDFLYERVNDG
VYRAGFATSQQVYERAARSVFVALDQLNTRLGDRRYLFGAQFVESDWRLFVTLLRFDAVY
HGHFKCNLRRIVDYPHLYGYLRDLYQVTGIAETVDFDHIKRHYYVTHDDINPTRIVPIGP
MLDLLSPHGRSGLS
Download sequence
Identical sequences D8PJ48
WP_013250105.1.3676 gi|302038888|ref|YP_003799210.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]