SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302038917|ref|YP_003799239.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302038917|ref|YP_003799239.1|
Domain Number 1 Region: 19-283
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.72e-85
Family G proteins 0.0000639
Further Details:      
 
Domain Number 2 Region: 267-399
Classification Level Classification E-value
Superfamily Translation proteins 8.43e-28
Family Elongation factors 0.0031
Further Details:      
 
Domain Number 3 Region: 399-472
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000000000612
Family EF-G/eEF-2 domains III and V 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302038917|ref|YP_003799239.1|
Sequence length 542
Comment peptide chain release factor RF-3 [Candidatus Nitrospira defluvii]
Sequence
MSLPVEKSAADELRREVLRRRTFAIISHPDAGKTTLTEKLLLYAGAVHLAGAVQARSTQR
QAKSDWMELEQARGISITSTMLQFDYQGARVNLLDTPGHQDFSEDTYRTLMAVDSAVMVL
DGAKGIEPQTKKLFAVCRKRGIPILTFINKMDQPGRHPFDLLDEIERTLGMTAVPFNWPI
GEGSGFQGVYDFQHRQVLFFQRTAHNQRRAPMTVEAFPNPKLAETLGEAYGPLQEEIGLL
TGAGTSFDRDRFLAGELTPVFFGSALTNFGVGPFLDAFTKLAPPPGPRQTAQGLIQPTDE
AFSGFVFKIQANMDPQHRDRMAFLRICSGRFEKDMMVHHARLGRKIRMTRPHRLFGRDRE
TIDEAYPGDVVGLVNPGLFTIGDTLTSDPALTFDPIPHFPPECFGLLRTQDISKHKQFQK
GLKQLEEEGVMQIFYSPDHVRREPVLAAVGELQFDVVMSRLENEYGVKTSVERLPHALAR
WIVGNPATILAVYWPSDTIRLVDQQGRGVMLFTTEHLLAYCIKSNPSIKFLLREEVEQAT
AQ
Download sequence
Identical sequences D8PJ77
WP_013250134.1.3676 gi|302038917|ref|YP_003799239.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]