SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302038972|ref|YP_003799294.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302038972|ref|YP_003799294.1|
Domain Number 1 Region: 38-68,112-164,206-236,263-393
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.02e-25
Family Lysophospholipase 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302038972|ref|YP_003799294.1|
Sequence length 1157
Comment hypothetical protein NIDE3691 [Candidatus Nitrospira defluvii]
Sequence
MWKACTSVGTLAFTFTLLLPLTAFPSHPHSEYDQKAAPWIGISLSGGGLRAAAFSHGVML
ELRKLCVLKPQEDSTDSDNHNGYKAPPTRFSLQYLEDKDFSDDDRSSPCGQGGRASFLDN
THFLSGVSGGAITAAYYKTHPNRLAEFGQSLKDARLARQLISGKKKTPIWRPPVMLFASL
LDTIFQTFKLPILPVPEVEVAPLATMWLYDGLFEGEQLRPVYNDLFLHGHTFGDLEEQTT
RTETLAGSLFGKAGNHQSNIGQAKLLINATDIVNGRVFTFDKETFACLGDVDGFRKLDLA
TAVAASSSLPGIFSPIRLKSLLQNTEAKLIPTNCPLIVGDQVRSPILVDGGVSDNLGVTG
LLRAIFERKNRDEFREEEQALANGHGLIVSPGETARSFLANAEITDLTTAQKANPKSQKA
FLLIVNAGVSATSSLPGMGGHLDDSFDVLMRDRTDLSRIVAQQMLDNFGFGVVELNMRDL
VKNSRVVTRIVRQSLLIQRKTNSTTDSINEVAQTFDFTEMERKVLSDLNNVGLLPSKDEI
DTLILAGRAVVAEMSGTIKKQYEELADKRYAASCDRIVNPGRHYCWPTNFETPHLVANKV
GVLLEVLTKTSEDFSKKITENRSTQLTQLRSTLWDLYANERRALDLLEIPASSMEFDQFM
KCRIKQDMIIRSAFGSQSSIGSLPYCDLCIEFHLPPQSLLRSTVDSVPACDSSEGEPEKS
LSNSPTTKLAGLLTALPTPPDMKGYVSALLNPKPPSSTITTEKKAIDSWAEKFIAHLLTD
PGAHVESPLYDWLLARFSMLQGKTTEGFHYLYRGVTTFPDDYNLSFLLGHYSIHLNRDFH
GGLDQLFLAREKAEAKKKRIDWLPDTALKDKHVARKRFSRAEEYFALQYAKYIALSPSPV
EGRSEFILGQDVDAWLNQTFPNGHGSNELSTLTTFAEGSNETTIETVNVACRNIRKSVDK
LSLPIGVKKAIEALLGHFKQIAPECQADDKTQPDDYALLEEDDLRGGSSCGDNPTSNLPS
VRNTFSARLQICQDFANVRHRIRELLAHKTALFYARAQARKLYESESVLEQQTKSSPFLW
ERADVYGLIALIDATQKECPQRTPDIHAALRLFHVARASVDQDKRLAIDKRFIEGVKKRI
SRLVEVTEEFSCGRDLD
Download sequence
Identical sequences D8P7M3
gi|302038972|ref|YP_003799294.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]