SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302038992|ref|YP_003799314.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302038992|ref|YP_003799314.1|
Domain Number 1 Region: 115-233
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 5.49e-19
Family Band 7/SPFH domain 0.0051
Further Details:      
 
Weak hits

Sequence:  gi|302038992|ref|YP_003799314.1|
Domain Number - Region: 225-270
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0275
Family F1F0 ATP synthase subunit B, membrane domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302038992|ref|YP_003799314.1|
Sequence length 345
Comment FtsH protease activity modulator HflK [Candidatus Nitrospira defluvii]
Sequence
MVWDPKDPWSKKGDDLDQAFKQAQGQLRNLLPTGGFRNLLLVAFTVFLIWQSAFIVAPDE
EGVVKRFGIPVRVVDPGPHMKIPIIESVLQPKVAKLHRVEIGFRKDRQGRQQMVPQEALM
LTGDMNILAIEFIVQYKIKSSREYLFNVADIDETIGKAAEASMREVIGKSKIDEALTTGK
AQIQNDTQELLQHILDDYRTGVQVAAVQLQDVDPPEAVAAAFKDVTNAKEDREKLINQAQ
GYRNDITPKAKGEAAQLVNQAKGYAQARLNRSQGESNRFLATLKEYNQAKDIISKRIYIE
TLEDVLPHIDKFVLDGKGADRALPYLPLDRFSKPAPSSSTQERTP
Download sequence
Identical sequences A0A1W1HWZ7 D8P7P3
gi|302038992|ref|YP_003799314.1| WP_013250209.1.3676 WP_013250209.1.96234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]