SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302039051|ref|YP_003799373.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039051|ref|YP_003799373.1|
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Ribosome binding protein Y (YfiA homologue) 3.01e-16
Family Ribosome binding protein Y (YfiA homologue) 0.0036
Further Details:      
 
Domain Number 2 Region: 113-174
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000416
Family Cold shock DNA-binding domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302039051|ref|YP_003799373.1|
Sequence length 181
Comment cold shock protein modulated with ribosomal subunit interface-like protein [Candidatus Nitrospira defluvii]
Sequence
MNLEVESRNIDMTPRWKTEIEERMATLQRGHDDIIHGRVTLTKNRHHKKLDNVAEALVLV
TVPTRHTITSRKEDKTFEEAIRAAFDAVAIELRKYREKRADKVVRIEPLPQLRGVVSKVF
PHLGYGFILKDGGGEVYFHKNAVKGIPFNDMEDGQEVIFESEPGEKGLHATIVQPPHALE
V
Download sequence
Identical sequences D8P7V2
gi|302039051|ref|YP_003799373.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]