SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302039130|ref|YP_003799452.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039130|ref|YP_003799452.1|
Domain Number 1 Region: 172-389
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 6.67e-61
Family CAT-like 0.000072
Further Details:      
 
Domain Number 2 Region: 2-90
Classification Level Classification E-value
Superfamily Single hybrid motif 7.98e-24
Family Biotinyl/lipoyl-carrier proteins and domains 0.00053
Further Details:      
 
Domain Number 3 Region: 115-154
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.00000000889
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302039130|ref|YP_003799452.1|
Sequence length 390
Comment putative pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase (E2) component [Candidatus Nitrospira defluvii]
Sequence
MAEFLMPTLGADMTDGTLVQWKKKEGDRIAKGETIAEVDTEKAAIDVESHTTGIIERLIT
RPGDKVPVGTVMAIIREEGGPTTSVASPRAVATPPSPPPPSPRTERAAVAPSQVGRLRIS
PAAKKLAAERGIEASTLQGTGPEGAITLDDIDRATTATTDIAKPVGTADRQARMRQTIAA
AMARSKREIPHYYLSTTIDMGRAITWLKDSNEQRPVTERLLYGVLLIKAVALALRRVPEL
NALWKDGEAHRSERIHIGTAISLRQGGLVAPALHDADRLSLSELMQNFQDLVKRARAGSL
RSSELSDPTITVTSLGEQGVETVFGVIYPPQVALVGFGKVVERPWVADGLVVPRPVLMAS
LSADHRVTDGHRGGLFLAEIDRLLQEPQSL
Download sequence
Identical sequences D8PJF3
WP_013250347.1.3676 gi|302039130|ref|YP_003799452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]