SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302039164|ref|YP_003799486.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039164|ref|YP_003799486.1|
Domain Number 1 Region: 7-264
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.29e-72
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00000314
Further Details:      
 
Domain Number 2 Region: 354-438
Classification Level Classification E-value
Superfamily Cytochrome c 9.18e-22
Family monodomain cytochrome c 0.043
Further Details:      
 
Domain Number 3 Region: 264-344
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000000000763
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302039164|ref|YP_003799486.1|
Sequence length 441
Comment quinol-cytochrome c reductase, fused cytochrome b/c subunit [Candidatus Nitrospira defluvii]
Sequence
MSSRLYDWLDRRLNLKPVQRTLLDEPIPGGASWIYVFGSVTLFLFVLQAATGMFLALYYA
PTPDHAYDSVRFIETEITFGWFVRGLHHWGASSMVVAIGLHMLQTFLYGAYKKPREVMWM
VGVVLFLVVMTFAFTGYLLPWDQTAYWATQIGINMVGTVPLIGDFFSRVLRGGEILGALT
LSRFFAIHVLFLPAILIGGIALHLFVLRRVGPAGPWTDDRASLASETFAPRQVYMDAVVI
AAVFLVVATLAFSIPLPLTDKANPSDTSFVPVPEWYFLFYYELLKYVHGPLEPLATWVLP
LCVILIMLFWPFIDRNPVRNPIRRPAALGSGLLFLFVVFGLLGISLKNLYAVPRTDPAVA
QGRAIYAQLGCAGCHRIHGEGGAVAPDLSTIGYTRPDRAWHLKHFRDPQSVSPGSFMPKF
PLTDQQLNDLTSYMLSLKRAT
Download sequence
Identical sequences D8PJI7
gi|302039164|ref|YP_003799486.1| WP_013250381.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]