SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302039224|ref|YP_003799546.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039224|ref|YP_003799546.1|
Domain Number 1 Region: 175-394
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 4.31e-73
Family CAT-like 0.0000642
Further Details:      
 
Domain Number 2 Region: 2-86
Classification Level Classification E-value
Superfamily Single hybrid motif 3.66e-25
Family Biotinyl/lipoyl-carrier proteins and domains 0.00041
Further Details:      
 
Domain Number 3 Region: 118-163
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0000000000615
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302039224|ref|YP_003799546.1|
Sequence length 400
Comment dihydrolipoamide acetyltransferase (E2) component of pyruvate dehydrogenase complex [Candidatus Nitrospira defluvii]
Sequence
MASRVVMPKLTDTMEEGVLLAWKKREGDRVHAGEVIAEIETDKAVMDLEAFAPGILRKIL
VRDGETVQSGTLIAVIAEADEDITAALSDGVTAAPSIGSGAKTGAAPGEVSAPVTAARPE
GARPFASPRAKALAAERGIDLSALTGSGPGGRIVEDDVRQATAQPAPALPAGIDQPLSQM
RKAIARATVQSKAPVPHFYLTVEIDMEQAERVRDQFKQSRQTHPSVTDLLIKAAALALRR
HPEINVSFAGDAIRRFEQIDIGVAVGMEDGLITPVIRDCGAKTLTEISAETKSLIERARQ
KRLQPQEYTGATFAISNLGMFDVDNFIALLMPPQAASIAVGAIRDVPVVTKGTVTAGRRM
KVTMSCDHRALDGLMGAQFLKEFKRVLEHPQELVAPVVNP
Download sequence
Identical sequences D8P7Y9
WP_013250441.1.3676 gi|302039224|ref|YP_003799546.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]