SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302039265|ref|YP_003799587.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039265|ref|YP_003799587.1|
Domain Number 1 Region: 62-327
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 1.29e-39
Family Lambda integrase-like, catalytic core 0.0051
Further Details:      
 
Weak hits

Sequence:  gi|302039265|ref|YP_003799587.1|
Domain Number - Region: 10-67
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 0.0418
Family Methionine synthase SAM-binding domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302039265|ref|YP_003799587.1|
Sequence length 391
Comment putative phage integrase [Candidatus Nitrospira defluvii]
Sequence
MKTTRTMTPQGMRSLLDFRYRGVRYRPVLGYNLTPDQEHEAMVQVLAAIQSQIRPDATTT
GLTFAQFVPKYLDRLNGKALAALDRPRTILTRHLVPFFGIRPLQSMKLEDGVAYIAHRRA
EMAADGTIRRECGVLLGLLNYAVANEDLDKNRLLALDLPAGAQRTRVAKPWELYRIYHLS
APAIQRMMMLALLTGLREAKIIAIDQEWIIEPADGEWLIPVQGSRLKRVPEELPLSPLAA
SFLRGTLPRIGGRFFSQWRDAGSFKHRWAEACARAGVQDLHFHDLRHTAATWLCEAGVEY
ATTEKLLGHRLPGMGELYMHNWKPKLRMAVTTLEAIAFERFREASHEAGAGVQNRSHTHS
TLAGWWESMPASRSAISNRSLHTSQLKGVSV
Download sequence
Identical sequences D8P830
WP_013250482.1.3676 gi|302039265|ref|YP_003799587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]