SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302039295|ref|YP_003799617.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039295|ref|YP_003799617.1|
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.2e-30
Family Transcriptional regulator Rrf2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302039295|ref|YP_003799617.1|
Sequence length 159
Comment putative transcription factor IscR [Candidatus Nitrospira defluvii]
Sequence
MLKLSKKADYGLMALQHIASNQYGDVAQARVVNTKEIAEEYHIPVELLAKVLQTLSKSGI
IESHNGPKGGYLLGKNPREITIAHVLESLEGPLGIMDCSHEKDGDACMQREHCNIRTPLL
KIQSSIYQLLNNMTLQDMMGGTPLITIQSVATEQQGVER
Download sequence
Identical sequences A0A1W1HW02 D8P860
WP_013250512.1.3676 WP_013250512.1.96234 gi|302039295|ref|YP_003799617.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]