SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302039302|ref|YP_003799624.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039302|ref|YP_003799624.1|
Domain Number 1 Region: 229-251,278-330,441-773
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.25e-135
Family beta-Lactamase/D-ala carboxypeptidase 0.000098
Further Details:      
 
Domain Number 2 Region: 59-280
Classification Level Classification E-value
Superfamily Lysozyme-like 1.86e-75
Family PBP transglycosylase domain-like 0.00000271
Further Details:      
 
Domain Number 3 Region: 355-438
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000156
Family Cold shock DNA-binding domain-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302039302|ref|YP_003799624.1|
Sequence length 797
Comment penicillin-binding protein 1A [Candidatus Nitrospira defluvii]
Sequence
MSELDHLLDKPEKPRRRWRWWKIAVIGLLLAIVLGGGGVAGILWYFSQDLPSLDPLQNYQ
PSLVTRVYSDDRQVIGQFFIERRFLKPIQEMPKSLTQAVIATEDTRFFEHPGLDIVGILR
AAWTNIRHGGRKVEGASTITQQLARSLFLSAERTFDRKVRELILAYKMELVLTKEQILEM
YLNQIYFGQGAYGVAAASQTYFGKELSKLTLAESAFLAGLPKSPSHYSPFKAYDRAKKRQ
EHVLSRMAEAGFINAADREQAVAEKLNFRRPGSEHLGPYFVEYIRQLLVAKFGEAMVYKG
GLEVFTTLNADMQKAAEAAVFNGLREVDKRQGWRGPLRTVDLATLEVPAPDPSVKLAEGD
IMEGVVTKIAKDHVLVQIGGTTGRLAFDDMAWATKYLKGKDPTKDATPVKNLKQLLALGD
VIEVGVKKLEKETVHLRLEQTPLVEGALVAIDPKTGAIRAMVGGYDFARSEYNRAVLARR
QPGSSFKPIIYATAMNQGMSPATVVLDAPVVYEQEEEDKTWKPENYGKRFHGIVSLREAL
IHSHNLATVRLLDKVGIRNVIDFSRTVGIVSPLAADLSLALGSSGVGLTELVSVYGVFAN
QGMRVEPYAVASVQDSGGRTLDQAAIQPRQVVSRETAYLITNMMEDVIQRGTGVAAKAVI
DRPVAGKTGTTNDFTDAWFIGSTPNLATGAWVGFDDRRPLGETESGAHAALPIWISFMKD
ALKQLPVVPFEIPDGVMFVKVDPSTALLTDQDEQHGTVELFTKGTEPTKSAGSKIDPTEF
YKLDQVQDSAPAVPVEP
Download sequence
Identical sequences D8P867
WP_013250519.1.3676 gi|302039302|ref|YP_003799624.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]