SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302039303|ref|YP_003799625.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039303|ref|YP_003799625.1|
Domain Number 1 Region: 19-224
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.93e-57
Family G proteins 0.00017
Further Details:      
 
Domain Number 2 Region: 169-317
Classification Level Classification E-value
Superfamily Translation proteins 1.01e-26
Family Elongation factors 0.0052
Further Details:      
 
Domain Number 3 Region: 416-534
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 9.11e-21
Family EF-G/eEF-2 domains III and V 0.013
Further Details:      
 
Domain Number 4 Region: 320-405
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 9.71e-16
Family EF-G/eEF-2 domains III and V 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302039303|ref|YP_003799625.1|
Sequence length 627
Comment GTP-binding protein TypA [Candidatus Nitrospira defluvii]
Sequence
MNSSAPSSTTSGLHAPQGRRTDIRNIAIIAHVDHGKTTLVDAVLRQTHVHRKIDDMGERI
MDSMDQERERGITIRAKNASVTYKGVKINIVDTPGHADFGGEVERTLRMVDGVLILVDAK
EGPMPQTTFVLRKALALGHKAIVVINKIDRPDAVIDDVVNRTFDLFVHLGATDEQLDFPI
VYTSAIKGVATLDLKQPGTEISPLLETILDKIPAPAINADAPFQLLVLALAQDSYKGKMG
IGKIQSGSIARRQNVVTLTKDGGQVPGKISDLAVFSGLERTDVETAEAGEIIALSGLEEV
NIGDTIADPTNPVALPRVTIDEPTVQMTFSVNNSPFAGRDGKYLTSRHLRERLFKELETN
VSLRVQETDSADRFLVAGRGELHLGVLIEQMRREGYELQISQPEVILHREGDTVTEPFEE
LTIQVPSEYQGPVIEEIGKRRGELRHMKLVHSEGTASEMHIEYHIPTRGIIGLKNILLAK
TRGTIILHHVFSGYAPADEKALLVAPHGSLVAFEAGTSTAYALFMTQERGELFIGASVEV
YQGMVVGQNSRDEDLDVNVCKQKQLSNMRAAGTDEALVLTPPREMSLEFAMEYIGQDELV
EVTPKYLRLRKRLLNPDDRRKAKKSSK
Download sequence
Identical sequences D8P868
gi|302039303|ref|YP_003799625.1| WP_013250520.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]