SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302039305|ref|YP_003799627.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039305|ref|YP_003799627.1|
Domain Number 1 Region: 7-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.91e-46
Family Glutathione peroxidase-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302039305|ref|YP_003799627.1|
Sequence length 156
Comment peroxiredoxin [Candidatus Nitrospira defluvii]
Sequence
MSDVAAEIKVGDTAPDFTLKDQDQKDVKLSDFRGKSNVVLAFYPLDWSPVCQGENKCLTD
DFPKFQSAHAELFGISCDSFFSHKAWADSLDLKHRLLSDFNREVVKKYGLYFEPLNCGKR
ATVIVDKNGKVAYVKVQEIKVAREDKDILAALAKLS
Download sequence
Identical sequences A0A1W1HVZ2 D8P870
WP_013250522.1.3676 WP_013250522.1.96234 gi|302039305|ref|YP_003799627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]