SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302039306|ref|YP_003799628.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039306|ref|YP_003799628.1|
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000499
Family Thioltransferase 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302039306|ref|YP_003799628.1|
Sequence length 110
Comment putative thioredoxin [Candidatus Nitrospira defluvii]
Sequence
MTGTVQDVRDENYKEFTESAGAVVAYGLATCEPCKQYDPILEETAAKFPTIKIGKAKMHV
PGRCREIKKAHTFETYPTTHFFAQGKLLLTREGVVEPAELAALISDHLLK
Download sequence
Identical sequences A0A1W1HW21 D8P871
WP_013250523.1.3676 WP_013250523.1.96234 gi|302039306|ref|YP_003799628.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]