SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302039393|ref|YP_003799715.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039393|ref|YP_003799715.1|
Domain Number 1 Region: 283-586
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.4e-82
Family DNA repair protein MutS, domain III 0.00000181
Further Details:      
 
Domain Number 2 Region: 589-824
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.16e-58
Family ABC transporter ATPase domain-like 0.00000069
Further Details:      
 
Domain Number 3 Region: 5-114
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 2.62e-39
Family DNA repair protein MutS, domain I 0.0000249
Further Details:      
 
Domain Number 4 Region: 116-294
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 4.97e-30
Family DNA repair protein MutS, domain II 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302039393|ref|YP_003799715.1|
Sequence length 882
Comment DNA mismatch repair protein MutS [Candidatus Nitrospira defluvii]
Sequence
MGDADGTPLMRQYRDIKQAYRDAILFFRVGDFYEMFQEDAVEASKLLSIALTSRDKSSGT
PIPLCGVPYHAATNYIAKLLRAGRTVALCEQVEDPKLAKGLVRREVVRLYTPGTLIDSEF
LPSTESNVLAAVSVRLRSAGTGRKDCSYGLATLEVSTGDYWLSEFHGPQAEAALRDELAR
LEPRELLFPENLSPDELQWTADLTGPRCCTQPATWFDQEQGRIALQEQFHVHSLEAFGCH
ILTLGIQAGAAVLRYVRETQPSAPLDHIRPPRVRQDDDAMHLDSVTIRNLELVKPAGRAE
ESSNQSPYTLLGILDRTVTAMGSRLLREWLLRPLVNSAAIEVRLTAVDELKRQIDIRVRL
RTALRIVQDISRLCSRMSLGVANPRDVLALKISVSSLPAIQAELSALDSPLIADLRSSWD
NAQDLYELIEGAIEQEAPVSIRDGSILKSGFHPEVDELRKASREGKGWIAGLEAKERERT
GVESLKIRYNQVFGYYIELTKANLGKVPPDYIRKQTLVNAERFMTTELKELEERVTGADT
KLTALEQALFEQLRTRLATETARLQEISRRLAILDVVAALAETAALNRYVRPTVDEGDGL
HILQGRHPVVERLDLSGGFIPNDTHLDLATSRLHILTGPNMAGKSTYLRQVALITLMAQM
GSFVPATEARIGLTDRIFTRVGASDNLAGGQSTFMVEMTESAHILNCATPRSLILLDEIG
RGTSTYDGLSIAWAIAEYIQDPQRLGARTLFATHYHEMTQLESLREGITNYCVAVQERDG
RVLFLRKIIRGGADRSYGIHVAQLAGLPDQVIHRAKAVLAQLESSSSSGRPVQDNQQSLH
FDATLPPPHPMLEEVRQMDLFSMTPLDALNRLAELQQRLLKE
Download sequence
Identical sequences D8P8F8
WP_013250610.1.3676 gi|302039393|ref|YP_003799715.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]