SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302039398|ref|YP_003799720.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039398|ref|YP_003799720.1|
Domain Number 1 Region: 294-485
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.67e-50
Family Ribonuclease PH domain 1-like 0.0000158
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-50
Family Ribonuclease PH domain 1-like 0.0000202
Further Details:      
 
Domain Number 3 Region: 143-229
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.27e-28
Family Ribonuclease PH domain 2-like 0.0021
Further Details:      
 
Domain Number 4 Region: 450-557
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.8e-27
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 5 Region: 552-637
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.59e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 617-694
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.27e-21
Family Cold shock DNA-binding domain-like 0.00029
Further Details:      
 
Domain Number 7 Region: 237-317
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000201
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302039398|ref|YP_003799720.1|
Sequence length 705
Comment polyribonucleotide nucleotidyltransferase [Candidatus Nitrospira defluvii]
Sequence
MKHVVDIELAGRRLTLETGRIAKQADGAIWATYGDTVVLATAVASQNAKPGVDFLPLTVD
YQEKTYAAGKIPGGYFKREGRPSEREVLTSRLIDRPLRPLFPEGYYFETQVIASVLSADK
TGVSDVIGIIAASAALAVSSIPFNGPIAGVKIGRVNGQFVVNPDLETLETSDLHLVVAGT
ADAVMMVEAGANELPEATMLEAIELAHSEIKKIVAKIEELRKLVGKVKRVVVQEAIDAAL
TEQVRALVAGPIREAILIPNKSARQERLDQVLAETVAKLKSDEPNRDRHVKIIFHGLEYT
EVRNMILEKRVRADGRGPADIRPITCEVGVLPRAHGSAVFTRGETQSLAVVTLGTTDDEQ
RIDALEGEYMRTFMLHYNFPPFSVGEARPLRSPGRREVGHGALAERALKSIIPGKDKFPY
TVRIVSEILESNGSSSMATVCGGTLALLDAGVPIKEPVAGIAMGLIKEGDQVLVLSDILG
LEDHLGDMDFKVTGTKNGVTALQMDIKIGGITAGLMREALAQAKAGRLHILGCMAQALTE
PRTKLSAFAPRIFPMKIKQDKIRDVIGPGGKMIRSIIAETGVKINVEDTGDVTIASSDEA
SAQKAIDMIKRLTEEVEVGKIYLGTVRKIMDFGAFVEVLPGTDGLVHISQLAHHRVKAVT
DEVSEGDQVMVKVLEIDKQGKIRLSRKEAMPAPAGSPATEPTPAG
Download sequence
Identical sequences D8P8G3
gi|302039398|ref|YP_003799720.1| WP_013250615.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]