SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302039404|ref|YP_003799726.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039404|ref|YP_003799726.1|
Domain Number 1 Region: 348-523
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.22e-52
Family G proteins 0.00012
Further Details:      
 
Domain Number 2 Region: 631-757
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 1.7e-34
Family Initiation factor IF2/eIF5b, domain 3 0.003
Further Details:      
 
Domain Number 3 Region: 752-845
Classification Level Classification E-value
Superfamily Translation proteins 9.03e-29
Family Elongation factors 0.000021
Further Details:      
 
Domain Number 4 Region: 523-605
Classification Level Classification E-value
Superfamily Translation proteins 4.47e-23
Family Elongation factors 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302039404|ref|YP_003799726.1|
Sequence length 865
Comment translation initiation factor IF-2 [Candidatus Nitrospira defluvii]
Sequence
MRVYELAKQLGMENRELIPELKRLGIPVASHSSALDDDSVRVVLEKLGSKARSGEAVSGG
HEGKKMVRPSKEPGASHERGHAAAHEEPPKPDKKRILIKKKREEGAEDVAASLAAAEAAF
APVVPAGSEASAVAPVAGSDAEAIEAAPVEPPPSEEVVSPTPVVTVSEEPLVKPVQAPQV
TAPPLDALAAAKKKSAATEAMESEAAAREKLKKVKKAPRTREEDEAKFKNDATRWGDLRA
IPVQRREDRSKHIHHASPSEVTKPRKKSVKLSAGVSVKEFAELIGQRPADVVRKLMEMGQ
MVTFNQSINLEAASLIAEEYGAKVEVSTEKIGEALLEEAAQSTGEEHAVLRPPVVTIMGH
VDHGKTSLLDAIRLTKVAEGEAGGITQHIGAYIVGVRGKQVTFLDTPGHEAFTAMRARGA
KATDIVILVVAADDGVMPQTVEAIHHAKAAGVPLIVAINKVDKPGANIDRVKNALTEHGL
VPEPWGGDTIMVEVSAKQRTGLDQLLEMILLQAEVLELKADPSRMAKGLVIEAKLDRGRG
PIATVLVQSGTLHVGDAFVVGNFSGRVRALITDTGSKATEAGPSVPVEVIGLPGVPSAGD
LFTIVKDERVAREIAQERAMKQRAADLAGPAKVSLDDLFAKIQEGNVKELPIVIKADVQG
SAEALAAAVEKMPAGAVKLRVMHTGVGGITETDVLLAAASKAIVIGFNIRPEPKAAALAE
REGVDVRLYSIIYDALNDIRAAMEGLLEPTLKERVLGRAEVRQMFTIPKAGLVAGCYVVD
GVISRASVGVRVLRDSVVVYEGKLGSLRRFKDDVREVQQGYECGITVENFNDLKAGDIIE
AYVVDKIAAKLEPANRGTSPQSHRA
Download sequence
Identical sequences D8P8G9
WP_013250621.1.3676 gi|302039404|ref|YP_003799726.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]