SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302039405|ref|YP_003799727.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039405|ref|YP_003799727.1|
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily Transcription factor NusA, N-terminal domain 7.72e-39
Family Transcription factor NusA, N-terminal domain 0.000077
Further Details:      
 
Domain Number 2 Region: 199-276
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.18e-29
Family Prokaryotic type KH domain (KH-domain type II) 0.0000876
Further Details:      
 
Domain Number 3 Region: 132-198
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.89e-17
Family Cold shock DNA-binding domain-like 0.0046
Further Details:      
 
Domain Number 4 Region: 278-342
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.00000000000000118
Family Prokaryotic type KH domain (KH-domain type II) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302039405|ref|YP_003799727.1|
Sequence length 379
Comment transcription termination factor NusA [Candidatus Nitrospira defluvii]
Sequence
MNRELIAVIDEIGRQKGIDKARVIGAIESALQTAAKKRFGQAENIQVEIDPKTGEISVVS
KKIIVDTVANPKAEISLKEAREYDEGAEVGDEIGSLIEMDELGRIAAQTAKQVIFQKVRE
AEWEAVQKEYSTRQGDLVNGIILGMERRNFLVDLGKTEAILPIQEQIPRETYRRGDRVKA
LLLEVRRTPKDVQVILSRSHPQFVAKMFELEVPEVGEKIVEIKSIVREPGDRTKIAVSSR
DKAVDPVGACVGIKGSRVQAVVRELRGEKIDIITWTQDPRVFIAEALNPATIEKVGIDEE
KKSALVVVADSQLSLAIGKNGQNVRLAARLTGWKIDIISATEYEKEKAERDRDIKAALAE
ETEAQRQQDEARAAAQQAE
Download sequence
Identical sequences A0A1W1HVM7 D8P8H0
gi|302039405|ref|YP_003799727.1| WP_013250622.1.3676 WP_013250622.1.96234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]