SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302039504|ref|YP_003799826.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039504|ref|YP_003799826.1|
Domain Number 1 Region: 4-199
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.48e-21
Family Extended AAA-ATPase domain 0.0015
Further Details:      
 
Domain Number 2 Region: 209-328
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 1.45e-20
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302039504|ref|YP_003799826.1|
Sequence length 364
Comment putative DNA polymerase III subunit delta [Candidatus Nitrospira defluvii]
Sequence
MSLELPQSLARSGVMPLYAVVGEEDYLRDQSVAALRAAALGPAADTGFNCDIFHGDDCSV
EDVLACASEIPVFAERRVVVYKSVEKLPAREGEKLLSYFAAPNDTTTLIVVAAKLDGRMK
WTQALTKGGVTVNCAPLRDAQLSAWIRQEAAALGVRIHEEATQLLKEVGSESLYAVKREL
EKLAAYVPPDRTAQLADVEALRGTESGASVFDLMNAIGAHDHGRALRILARNLENGEAPL
RILGALVWQYRRLWKMKEQLKSGGREGEAARTLRIDPSRVRGFLAQFSDAQLTQTFRWFL
DTDSKLKGGSGSAPVRVMEDLLFRLCGQPSKSASSGARVQPAPPVPRPTGSRPVSNVRTV
TRKR
Download sequence
Identical sequences D8P8R9
gi|302039504|ref|YP_003799826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]