SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302039576|ref|YP_003799898.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039576|ref|YP_003799898.1|
Domain Number 1 Region: 52-186
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 4.58e-41
Family Band 7/SPFH domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302039576|ref|YP_003799898.1|
Sequence length 312
Comment putative protease QmcA [Candidatus Nitrospira defluvii]
Sequence
MPGGLWVVIFLAGLVLLVISKTARVVPQQSAYVVERLGRYSRTLGAGFHILWPFLDSVQY
KHSLKETAIDIPEQICITRDNVQVGVDGILYSKVLDPQRASYGISDYRFAITQLAQTALR
SEIGKIELDRTFEERTNINSQVVNELDKATEPWGVKVLRYEIKNITPPKDVLAAMEKQMR
AEREKRAVILTSEGERDAAINQAEGEKQQVIKASEAKKQQQINEAEGAASAIMAIASATA
DGLRKVAESTQIPGGYEAVQLRVAEQYITKFGELAKASNTLVLPANVSDVGSMLTLAMNM
ITKRSSPTSPGK
Download sequence
Identical sequences D8P8Z1
gi|302039576|ref|YP_003799898.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]