SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302039659|ref|YP_003799981.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039659|ref|YP_003799981.1|
Domain Number 1 Region: 1-314
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.67e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000326
Further Details:      
 
Domain Number 2 Region: 323-415
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.33e-19
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302039659|ref|YP_003799981.1|
Sequence length 418
Comment histidyl-tRNA synthetase [Candidatus Nitrospira defluvii]
Sequence
MIKAIKGVKDLLPEESPRWRFIEDTARQWALRYGFQEIRVPIFETTTLFARSIGASTDIV
EKEMYTFADRDGSSLTLRPEGTAGTVRAFIEHNRAADPRPQKYCYAGPMFRHERPQAGRL
RQFHQFGVESFGVSDPRADVEVISLLWRLLSDLTLPGLTLEINNLGYTEDRARYKPLLVA
FLNGVQSRLCGNCQRRIETNPLRVLDCKVPECRSATEDAPRLADSLSSEARDHFERVTSG
LQSVGIPFHMNPRLVRGLDYYCLTAFEVTCSHLGAQNAVGAGGRYDGLVEQLGGAAVPAV
GFAVGLERIALMLPETVAVPSIPRVYVAAFGTQAVGLGFTLLDELRRTGVPADMDFRAAS
LKAHLRQADRLNALYTILLGDDEVTKGVATVRNMQTKAQEDVPIPDLASALRTRLVNR
Download sequence
Identical sequences D8P974
gi|302039659|ref|YP_003799981.1| WP_013250876.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]