SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036197|ref|YP_003796519.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036197|ref|YP_003796519.1|
Domain Number 1 Region: 54-301
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.04e-40
Family PFOR Pyr module 0.02
Further Details:      
 
Domain Number 2 Region: 308-419
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.64e-25
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302036197|ref|YP_003796519.1|
Sequence length 448
Comment 2-oxoglutarate:ferredoxin oxidoredutase subunit alpha [Candidatus Nitrospira defluvii]
Sequence
MSEALEPKQKTNPQGDSTTSVSAQKAETKKDPHADAKRQKVVTPEYMFLEAPRTKEFITG
SEAAKEAIRRSNVDLAIAYPITPQSETMQLVGVLYGEGYVKEYYRGEEEVGVMAAIAGGS
RAGVRCYTATAGPGTLRGLEGIASWPGHRLPVVAMFTCRVVNAPLAIQPDNIEVSYLLNC
GMIVFHAENQQDMYDFTLAGFVISEKNDVTLPVGVCCDGFFVTHARGYVRMQDRGMKLPP
REPWRGAVPVLDAENPPARLSRDAPVQKSNFMAYNIHAVWQQEVWAAVERSRKYINQYMG
GLLTAENVDDAEAVIIASGSAAAQSREAVRICAEKGIKIGLIKIRSLRPFPTQELRKLCG
KAKLIVVPEFNYVGWLAKEVATAIYGFSNAKIIGGPRVYGGQSMPVELIVDEVESGLTGK
KSTNVAISQVMGASAADHEAMGHFMRSI
Download sequence
Identical sequences D8PBI4
WP_013247419.1.3676 gi|302036197|ref|YP_003796519.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]