SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036337|ref|YP_003796659.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036337|ref|YP_003796659.1|
Domain Number 1 Region: 32-277
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.86e-44
Family PFOR Pyr module 0.0062
Further Details:      
 
Domain Number 2 Region: 285-390
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.02e-22
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302036337|ref|YP_003796659.1|
Sequence length 403
Comment pyruvate:ferredoxin oxidoreductase subunit alpha [Candidatus Nitrospira defluvii]
Sequence
MAEIKSHIGTQNKKGQTYTDAWKMMHEAPRNPSFYTGSEVIKEALRRASCDVMIAYPITP
QSEAAALIGELFAEGYIGDYFRGESEFAVMSQCAGAAFGGARVFTTTAGPGTMRAMENFP
MWAGARLPIQMIVTCRGINSPLSIQPDTIEISYLLNTGMLVWHAETAQDFFDWILKGFMV
SEEPEVHLPLALCCDGFFVTHTKDVVNLTPADMCLPPYDPYRSPVPCMDMECPPVRMMRD
PFIMKSNYISYATHASWQQEIWAAIERSRKHTIKWINGLIDTENTDAEVVIVASGTAVSQ
GREAIRLLEDEGVRCGLVKVKSLRPWPGEEIREATKNAKHIFVPEFNVTGWLAKEIKATI
PNSERVHAGPHVCGGMTMPPEIIASEIKTALGLRSESLAGRGS
Download sequence
Identical sequences D8PBX4
gi|302036337|ref|YP_003796659.1| WP_013247559.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]