SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302036660|ref|YP_003796982.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302036660|ref|YP_003796982.1|
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.11e-52
Family Cold shock DNA-binding domain-like 0.0000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302036660|ref|YP_003796982.1|
Sequence length 123
Comment 30S ribosomal protein S12 [Candidatus Nitrospira defluvii]
Sequence
MPTINQLVRKGRTLVKSKTKSPALKRCPQKRGVCLRVYTTTPKKPNSALRKVARVRLTNG
MEVTTYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGSLDAVGVADRKQARSKYGAK
RPK
Download sequence
Identical sequences A0A1W1HR79 D8PCU7
WP_013247882.1.3676 WP_013247882.1.96234 gi|302036660|ref|YP_003796982.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]