SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302038371|ref|YP_003798693.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302038371|ref|YP_003798693.1|
Domain Number 1 Region: 103-172
Classification Level Classification E-value
Superfamily PRC-barrel domain 0.00000000000000419
Family RimM C-terminal domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 8-96
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000000265
Family RimM N-terminal domain-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302038371|ref|YP_003798693.1|
Sequence length 175
Comment ribosome maturation factor rimM [Candidatus Nitrospira defluvii]
Sequence
MATLDQEELVTIGRIERSFGVRGEARVRSLTDVPGRFESLGQVTIVGPAGKTLDTRVTHA
RPGGPTWIVGFEAFTTPEQIAEFRGAFIQVPRGDSPALPVDQYYQCDLIGMVVQDEAGTV
LGCLEEVVSMSGNQNFLVRHDGKELLIPAAKQVVVAVDVPARIMTVRLPEGFGEL
Download sequence
Identical sequences D8PHN1
gi|302038371|ref|YP_003798693.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]