SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302038631|ref|YP_003798953.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302038631|ref|YP_003798953.1|
Domain Number 1 Region: 9-185
Classification Level Classification E-value
Superfamily MoeA N-terminal region -like 2.62e-51
Family MoeA N-terminal region -like 0.0000174
Further Details:      
 
Domain Number 2 Region: 186-330
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 4.19e-37
Family MoeA central domain-like 0.0000831
Further Details:      
 
Domain Number 3 Region: 335-412
Classification Level Classification E-value
Superfamily MoeA C-terminal domain-like 2.49e-21
Family MoeA C-terminal domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302038631|ref|YP_003798953.1|
Sequence length 432
Comment molybdopterin biosynthesis protein MoeA [Candidatus Nitrospira defluvii]
Sequence
MKAPDATTGLTPLHDAQRIVLDAAIPLGLEKISILDTLGRVLGEDIIAERHNPPWDNSAM
DGFAVRAEDIQQEHPISKPVTLTVIEDVPAGKMPTKSVGRGQAIRIMTGAPIPNGADTVL
KVEDTEHTPDSVRVFKPEPRGSNIRPQGEDVKKGDCIIPKGTTIRSGEAGMLAILAKSFV
LVYQRPRVAILSTGDELADLDERFSEEKIINSNSYGIAAAVQEAGGVPILLGIARDTPAA
LKEKISHGLNADILVLSGGVSMGDYDFTKAVFRDLGAEMNFWKLAIRPGQPLAFGKIQGK
LAFGLPGNPVSSMVTFEQLVRPAMLKLAGARGYGRPLLEAVFQEKFSKRTDRRHFLRGVL
WREDGVFKVRTTGDQGSGILTSMVKANCLIDIPVEVERINPGDSVTVQLLSGSAWLEQAA
PMVSTGHRPSCC
Download sequence
Identical sequences D8PIE1
gi|302038631|ref|YP_003798953.1| WP_013249848.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]