SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302038731|ref|YP_003799053.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302038731|ref|YP_003799053.1|
Domain Number 1 Region: 21-336
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.38e-64
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000989
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302038731|ref|YP_003799053.1|
Sequence length 369
Comment ATP phosphoribosyltransferase regulatory subunit [Candidatus Nitrospira defluvii]
Sequence
MKASSFSSPLVAGRERSLIPVGMSTILPDAARRIRQLEQTLLAVLARGGYEEIILPMFEY
LDVLAPGLESELIEKCYQLVDRTTGRLMLLRPDATAQIARTVAMGMMGEGLPLRLCYRTS
VFRYEREHAGRDREIFQVGAELIGVDGVAGDAEVLTLLLECLAQVGLSSFKVAVGHVGFF
TALLAKSGLSLEGQKRVEQAAARKDMPLLEELLAREGIPRSTGRVILEVLELCGGPEVLA
RGRKLVGRDRTLLKPLDRLAQVHERLVSPGQQAVLIDLGEFRGFEYYDGIVFDVFAPGIG
AELGGGGRYDHLMGRFGRTAASTGFGLDVDRLFRALDASGVVTPAHSNPSTSAGSKQVAA
ERRQRRSPV
Download sequence
Identical sequences D8PIP1
gi|302038731|ref|YP_003799053.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]