SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302039129|ref|YP_003799451.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302039129|ref|YP_003799451.1|
Domain Number 1 Region: 3-182
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.18e-64
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000741
Further Details:      
 
Domain Number 2 Region: 190-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.75e-38
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302039129|ref|YP_003799451.1|
Sequence length 324
Comment pyruvate dehydrogenase E1 component subunit beta [Candidatus Nitrospira defluvii]
Sequence
MTTITYREAVRSGLREALKRDPRVFLMGEDVGKYGGTYACSKGLLDEFGPERIRDTPLSE
STFVGAGIGAALGGMRPIVEVMTVNFSLLALDQILNNAATLRHMSGGQFNVPLVVRMATG
AGRQVAAQHSHSLEGWYAHIPGITVLTPATVTDAQGMLLAALQEPDPVFIFEHAYLYSME
GELEGSRPAVDISRAAVRRPGNDLSLITFGGSLWKALAAATQLAQEGIEAEVLDLRVLRP
LDTGTILTSVRKTHRAVVIDEAWRTGSFAAEIAAQIMEGAFYDLDAPVARVCSEEVPIPY
PKHLEEAALPQPDKIVKAVRRLLG
Download sequence
Identical sequences D8PJF2
gi|302039129|ref|YP_003799451.1| WP_013250346.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]