SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297619426|ref|YP_003707531.1| from Methanococcus voltae A3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297619426|ref|YP_003707531.1|
Domain Number 1 Region: 1-214
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.93e-62
Family Phosphate binding protein-like 0.0000254
Further Details:      
 
Domain Number 2 Region: 217-292
Classification Level Classification E-value
Superfamily GlnB-like 1.45e-16
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297619426|ref|YP_003707531.1|
Sequence length 293
Comment ATP phosphoribosyltransferase [Methanococcus voltae A3]
Sequence
MILLALPNKGRISKPVNEILEKAGLKITVRGRSLFANTVDEEIKVMFARAKDIPEFVADG
VADVGVTGYDLMLERNTEDRIDTLLDFKFGNARLVIASPENSEINSLEDIKDGMKIATEF
PCLTKKFLEKKGLNLEIIELSGATEIAPFIGIADLICDLTSTGTTLKLNRLKEVCEVVSS
TTRLVANKNSLVDDEKARKISELINAIKSVMYAQSKRLLMLNAPKSNLEEIIKVIPGMNG
PTISEVKPYKNDDVPMVAIQAVVEENQIFSIVNQLEQLEGRDILVVPIERIIN
Download sequence
Identical sequences D7DTU8
WP_013180286.1.83914 gi|297619426|ref|YP_003707531.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]