SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297619723|ref|YP_003707828.1| from Methanococcus voltae A3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297619723|ref|YP_003707828.1|
Domain Number 1 Region: 26-171
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-16
Family GHMP Kinase, N-terminal domain 0.0035
Further Details:      
 
Domain Number 2 Region: 245-285
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000576
Family Homoserine kinase 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297619723|ref|YP_003707828.1|
Sequence length 303
Comment shikimate kinase [Methanococcus voltae A3]
Sequence
MYSKCKAISHGSGTIINAIATNKGSAFGINLGVEATVELIDDHKNIIEGMADNGNISPNL
IGTCVKNVLDYYNLDYSAKVMTKSNLPIKSGLSSSSATANAVVLATMGVLGKYPIYEIQN
QNEIQNLTELDDLIINLGIKSCFDENLTITGAYDDATASYYGGITITDNQNRKIIKKDIF
KDENLKVIVLIPKDYEKNLNKDRMKLIKDYVGIAYENCLKGRYYEALFMNGMFYASTLNF
PTNISIEALEAGALTFGLSGTGPSYVGLCKPENVLNVVKSVEKYGIVHITEICNSKSNII
ILE
Download sequence
Identical sequences D7DUP5
WP_013180583.1.83914 gi|297619723|ref|YP_003707828.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]