SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386345849|ref|YP_006044098.1| from Spirochaeta thermophila DSM 6578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386345849|ref|YP_006044098.1|
Domain Number 1 Region: 295-479
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.33e-59
Family Adenylyl and guanylyl cyclase catalytic domain 0.0001
Further Details:      
 
Domain Number 2 Region: 198-245
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000432
Family HAMP domain 0.0078
Further Details:      
 
Domain Number 3 Region: 485-535
Classification Level Classification E-value
Superfamily TPR-like 0.0000268
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386345849|ref|YP_006044098.1|
Sequence length 553
Comment adenylate/guanylate cyclase [Spirochaeta thermophila DSM 6578]
Sequence
MSIRIKVVLVIIPILVLSLLMAGLSSYFFATSGITRIAREFLGFKAEELEKYMLTQWQVL
VESGLSDRPEMRSATQEGMASFAATLIRSTTELILAVDGEGALAFSTSPVELAPEDWGKI
REVFEAGRAEGFFTLRLGDTERVGRGFFFEPFSWYVVLTEARTTFYQDVEKITTQTIYIV
AGSILFASLLVFFFVGYLLRPLSRVVSTMQGIIASTDLSQRVPVEYHDEIGELSHTFNLM
VEGLDRAYTSIKNYAMDAVVARRNEMKIRNIFQKYVPQDIIDQFFEHPESMLVGDNRVLA
VLFSDIRSFTTISEGMPPDELVEALNRYFALMVDIITARNGIVDKYIGDAIMAFFGAPVK
RPDDGYNAVLAAIEMTEKVKEFNQRQVEEGKPEFRIGVGINYGLVTVGNIGCEKKMDYTV
IGDMVNLASRLEGLTKYYHQEIVISESLFRKVEGKLPVRLLDTVAVKGKHRGVRIYTVKR
ELSPRQGEIWKLHNEGMELYYTRRFDEAAVLFQRILELDPQDYPAQMLSKRCRLYVVEPP
PPDWDGVEKMLVK
Download sequence
Identical sequences G0GC17
gi|386345849|ref|YP_006044098.1| WP_014623787.1.62259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]