SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386346635|ref|YP_006044884.1| from Spirochaeta thermophila DSM 6578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386346635|ref|YP_006044884.1|
Domain Number 1 Region: 137-381
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 8.5e-30
Family Serum paraoxonase/arylesterase 1, PON1 0.085
Further Details:      
 
Domain Number 2 Region: 29-91
Classification Level Classification E-value
Superfamily TPR-like 0.0000000936
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Weak hits

Sequence:  gi|386346635|ref|YP_006044884.1|
Domain Number - Region: 454-621
Classification Level Classification E-value
Superfamily vWA-like 0.0912
Family Integrin A (or I) domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386346635|ref|YP_006044884.1|
Sequence length 669
Comment NHL repeat containing protein [Spirochaeta thermophila DSM 6578]
Sequence
MRMRWLVLWLGLAGGLLAQEVSIEGIRAEEEFRWGVRAFHLGFLHESILSFQKSLSYRPD
LLQAHLWLGRAYLRSGFYDAALTEWEYVLSHGHAPPYLQYKYETVKRWVGVLLEEDYRIS
FVSVFQKEAREGERILFRNPAGVDVGPDGSIWIAAFGSNEVVHLSPTGRFIQSFKGELGG
FSAPFDVKLSPDGFLYVSEFMADRISVLDRYGRRVRSFGKRGMGPGALLGPQYLAFDEQG
YVYVTEWGNRRVSKFTPEGEFLFSFGTGGSDFSGLQGPRGIAVRGGEVYVADTARGSIVV
FDTEGNYLREMGKGLFREVETLYPSDGRFFLTAGDRLLLYDPSTGSLARVGELSARRLMG
MARTPNGDLVVSDIDTNQVHFMVEVAAVYGGLYVDVERVDARDFPQVFVDVAVRDRDGRP
LVGLENSNFLFTEGGRNPGEVRLVFQADRSARSEVALILEHSPEMRRYAGRLSSLVASLL
PSLSSQGSVAVFAAKDEPVLLAESGQEEPLSPDRLVEGAFPSRWRPDLALRQAAFQVLKY
RGKRAVVFFSSGAFPPGAFSSYSIDTILGLFLQNEITLHVVDMSGGRTIPDELAYLVEKT
GGEVFDPSAPRGLSDLAQRIGSQHSGRYVLSYTSISNPDFGRSFIPVEVEVRFFSRSGRD
ESGYFGPAQ
Download sequence
Identical sequences G0GBT9
gi|386346635|ref|YP_006044884.1| WP_014624541.1.62259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]