SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386346752|ref|YP_006045001.1| from Spirochaeta thermophila DSM 6578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386346752|ref|YP_006045001.1|
Domain Number 1 Region: 240-358,404-446
Classification Level Classification E-value
Superfamily TPR-like 0.000000000132
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Domain Number 2 Region: 422-532
Classification Level Classification E-value
Superfamily TPR-like 0.00000000475
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 
Weak hits

Sequence:  gi|386346752|ref|YP_006045001.1|
Domain Number - Region: 34-137
Classification Level Classification E-value
Superfamily TPR-like 0.00235
Family Tetratricopeptide repeat (TPR) 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386346752|ref|YP_006045001.1|
Sequence length 535
Comment hypothetical protein [Spirochaeta thermophila DSM 6578]
Sequence
MKRIRWVGALALLLVVLSGLSLAVFFVWRDVTSWQDERSFQDLLDRVDEMLSSGKTVAAA
TILANMDRDLPRTSAGWLRVLKRAYLVEEMGGDYSVLLELGREAGSKYPGQARIWLLLIH
ALLSAGRPEEAMEVAWRHLPPSDYRYVFQSLWHALLEQHAEEFSIRRIQRMGSLFPFLLD
PDVYLSLGEELDDESFTMRGVLLLLQRDRAYHEAARILADLSGETARDLLVYILYDAGVY
EEVVERSEDFLRVPTPERLHLVAESLWHTGRITQASALYRHLIAAFPRHEPRAYHNLLVS
LLEERRLEEAEEVLEAGLRAFPGDGLLLRDRVRVLLFRGEEDEARILAASLDDPFARIVS
LLLEGRTHEPFLLRGEVWEMIEGHRGEEAAWEYGAWFFSSHGLWDDLEELLESGFGLWQG
RTWYRFYRGLVLLKRGNREGAKRLLSEVEGDYRAAALYDLALILGEEGRYREGAELLTRA
PLETFAKEEQLDLLTLRAWLLAASGSTGEARALLRQVLSVNPGTVDAAVLLRKLE
Download sequence
Identical sequences G0GCZ2
gi|386346752|ref|YP_006045001.1| WP_014624641.1.62259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]