SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386346876|ref|YP_006045125.1| from Spirochaeta thermophila DSM 6578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386346876|ref|YP_006045125.1|
Domain Number 1 Region: 742-816
Classification Level Classification E-value
Superfamily GreA transcript cleavage protein, N-terminal domain 3.14e-18
Family GreA transcript cleavage protein, N-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 819-893
Classification Level Classification E-value
Superfamily FKBP-like 2.62e-16
Family GreA transcript cleavage factor, C-terminal domain 0.0044
Further Details:      
 
Domain Number 3 Region: 138-270
Classification Level Classification E-value
Superfamily TPR-like 0.000000259
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Weak hits

Sequence:  gi|386346876|ref|YP_006045125.1|
Domain Number - Region: 49-170,212-276,481-626
Classification Level Classification E-value
Superfamily ARM repeat 0.00046
Family BC3264-like 0.079
Further Details:      
 
Domain Number - Region: 304-358
Classification Level Classification E-value
Superfamily CarD-like 0.017
Family CarD-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386346876|ref|YP_006045125.1|
Sequence length 898
Comment transcription elongation factor GreA [Spirochaeta thermophila DSM 6578]
Sequence
MSDALRKELQEKLNEEKWTRAALTSYSVTQFKELDDLIERIRKAGWSTEALQICEEHLEH
TKHSIVALYISGILKIEKRAVDDEHLVSLIQLFIDQRKWKIVEYLCQRVLEYGENRFALQ
TLAHWYETEGREADKVAIWERLIKVDYEEADLVKTLAEKKLEQGATEEAVDLYKKALHRY
IGKGDFPNVKEIWERLLTLAPQDISFFDHAESKIVTMLGEEKAIQLLYLLYEAHKDAEDQ
DIPISILKEILSYDPRDTRARKALVEAYRKKYAGHSNLEEYLKISNLTQNWRNVHEAIED
FERHIAFDEGNFVYHRTWGVGRIRSIKGDEVVIDFVKKRGHKMSLQLAIDSLQVLDKRHI
WVLKAVSSKEKLKKMFLSNVRWGLEVVIKSLENNASIRDIKSELVPSILSSREWTEWSER
ARELLKTDPMFGNVPNRSDRYMVRSHPVTFEEKIYLRFKAEKSFFARLKTMEEYLQQGEP
DSEFFNEMLEYFISFLKGEEITETTICSGLFLSRLLKQYPYLGERIQVDLLDLFSRLDDP
RTMKDVFAKIQDQDYRRLFLEFVKHNLPGWPRIFKDLFPQYLNRYIIESLREEDRTDVLQ
ELVDDLFDRYKEEREAFIWLIRNYLDEEWFRKTFELSFERILINFLHLLDITYREIENSK
NVVHNRKLNKQVYAFLFQEQRLEQYLLHASEEEVIRIYSLVEDVEGLDPATKIELRHLIM
EHFPGIKLPGREEREVVVPRGIMVTPAAYAAKQKELKYLHEVEVPKNSKEISQALLLGDL
RENAEYKAAKERQEMLNSTIGKLKEELERAQIVRPDEVDASQISFGTKVTLLNEETKKRE
TYVILGPWESNPDKGIISYLSPFGSELYGHKEGEELEFTINERTYHYVVEKIEKADMS
Download sequence
Identical sequences G0GE55
gi|386346876|ref|YP_006045125.1| WP_014624753.1.62259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]