SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386347123|ref|YP_006045372.1| from Spirochaeta thermophila DSM 6578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386347123|ref|YP_006045372.1|
Domain Number 1 Region: 246-370
Classification Level Classification E-value
Superfamily TPR-like 3.8e-29
Family Tetratricopeptide repeat (TPR) 0.002
Further Details:      
 
Domain Number 2 Region: 83-201
Classification Level Classification E-value
Superfamily TPR-like 0.000000000028
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386347123|ref|YP_006045372.1|
Sequence length 374
Comment hypothetical protein [Spirochaeta thermophila DSM 6578]
Sequence
MQEQTHDPLRHIVFISLPEDLDFSIEDFTIDPHIPLPVEPPPGKDAFSLEELSWEMILSG
ILKVLAYEPGDPHAAYYRRFAKAVRPSLTEELSETGVFKAKQGEYDLAEEIFLALIGLEP
ENPAHLLNLAVVYEERAKNYEKLGQEERAEEYRKNAAFTYNRLFLMEEGVPPAAYLNAGF
FYAEQHDYATALTYLKRFLDHPEAPPSRKGKVRALVEEIEKHHLYDELFQQAYEAIKGGR
EEEGIDLIRQFLEVYPEVWNAWFLLGWALRRKERYGEALEAFSRAESLHPDDADTLNELA
ICLIEEGRIEEAEEALNRALRKAPENTKIISNLAIVALKQHRVEEARRLFQVVLEFAPDD
PLALQYLKMLEDEV
Download sequence
Identical sequences G0GFW2
WP_014624991.1.62259 gi|386347123|ref|YP_006045372.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]