SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386347163|ref|YP_006045412.1| from Spirochaeta thermophila DSM 6578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386347163|ref|YP_006045412.1|
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-23
Family cAMP-binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 201-303
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000321
Family Tetratricopeptide repeat (TPR) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386347163|ref|YP_006045412.1|
Sequence length 325
Comment Crp family transcriptional regulator [Spirochaeta thermophila DSM 6578]
Sequence
MPRTVHYKASSVIYFEGDVGDKAYILREGEIVLTSTDLETGQEVHERIGKGEFFGVKSSV
GRYPREETAMVLSDAEVLEFSASEFEGFLLKNPRVMMKMLKVLSRQLRRIHKRVQTLLAV
SEEVNPEEGLFSICKYYIEKQQFSQAAYALGRYLAYYPDGVHVEEVKAALARVQAAQARG
GTGALSVPSPEPRKPSLSSAEKDFYEAESLFGQERYEEALASFMRIAEGSDQEDVRRRAL
FESGRCLMAMARYDEVIQHYSRFARDFSDAPETSEALFLIARAYEEKGDGARAGALYRKV
LSLPGVSSEVVKKARKALRGLEERV
Download sequence
Identical sequences G0GA07
WP_014625028.1.62259 gi|386347163|ref|YP_006045412.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]